Expression, Aufreinigung und Kristallisation des nicht-strukturellen Proteins 8 (nsp8) aus dem SARS-Coronavirus


Bachelorarbeit, 2004
46 Seiten, Note: 2

Leseprobe

Inhaltsangabe

1. Zusammenfassung

2. Einleitung
2.1 Coronaviren
2.2 SARS coronavirus und Replikationsstrategie
2.3 Zielsetzung

3. Materialien und Methoden
3.1 Materialien
3.1.1 Chemikalien
3.1.2 Geräte
3.2 Methoden
3.2.1 Expression von nsp
3.2.1.1 Expression der Vorkultur
3.2.1.2 Induktion und Überexpression von nsp8
3.2.1.3 Ernte und Aufschluss der E. coli Zellen
3.2.2 Aufreinigung von nsp
3.2.2.1 Aufreinigung mittels NiNTA Affinitätssäule
3.2.2.2 Elution des Nicht-Struktur Proteins8(nsp8) von der NiNTA Affinitätssäule
3.2.2.3 Einengen des Probenvolumens durch Amicon® UFZ
3.2.2.4 Aufreinigung des nsp8 durch Gelfiltration (Grössenfraktionierung).
3.2.2.5 SDS-PAGE
3.2.2.6 Bestimmung der Proteinkonzentration
3.2.2.7 Aufkonzentrierung der nsp8 Proteinlösung
3.2.3 Kristallisation von nsp
3.2.3.1 Phasendiagramm
3.2.3.1.1 Löslichkeitskurve (Solubility Curve).
3.2.3.1.2 Metastabile Zone (Metastable Zone).
3.2.3.1.3 Nukleationszone (Nucleation Zone).
3.2.3.1.4 Präzipitationszone (Precipitation Zone)
3.2.3.2 Kristallisation mittels Verdunstungsdiffusion am hängenden Tropfen
3.2.3.3 Kristallisation mittels Verdunstungsdiffusion am sitzenden Tropfen
3.2.3.4 Bestimmung der Löslichkeitsgrenze für (NH4)2SO4, PEG 6k und NaCl
3.2.3.5 Kristallisationsexperimente (Allgemein).
3.2.3.6 Kristallisation von nsp
3.2.3.7 Überprüfung der Kristalle

4. Ergebnisse und Diskussion
4.1 Expression und Aufreinigung von nsp8
4.2 Kristallisation von nsp

5. Literatur

6. Abkürzungen

Danksagung

Erklärung

Anhang (Abbildungen 19, 20 (a + b) und 21).

1. Zusammenfassung

Im Februar letzten Jahres (2003), wurde bei fast 9000 Personen rund um den Globus SARS diagnostiziert, wovon etwa 800 an den Folgen dieser Krankheit gestorben sind. Auch dieses Jahr sind wieder im Winter einige (~9) Fälle von SARS aufgetreten, die aber auf einen Vorfall in einem Labor in Beijing zurückgeführt werden konnten (www.wpro.who.int/sars). Der neue Coronavirus Typ wurde aus den befallenen Geweben der Patienten isoliert und als der Auslöser der Erkrankung erkannt. Bisher gibt es keine Behandlungsmöglichkeiten gegen diesen neu aufgetretenen Erreger.

Die Coronaviren sind positiv Einzelstrang (+) RNA Viren und gehören zusammen mit den Arteriviridae und Roniviridae zu der Ordnung der Nidovirales. Das Genom des SARS-Coronavirus umfasst etwa 30 kB und hat am 5´-Ende eine Cap-Struktur und am 3´-Ende eine Poly(A)sequenz. Nach der Infektion wird das 5´ - ORF (open reading frame) zu einem grossen Polyprotein translatiert. Dieses Polyprotein wird durch virale Proteinasen an konservierten Stellen geschnitten, wodurch einige nicht-strukturelle-Proteine, darunter RNA abhängige RNA-Polymerase (REP), Adenosintriphosphatase (ATPase) und Helicase (Hel) freigesetzt werden. Diese Proteine sind ihrerseits für die virale Replikation verantwortlich (Snijder et al., 2003).

Diese Arbeit befasst sich mit der Expression, Aufreinigung und Kristallisation des nicht-strukturellen Proteins 8 des SARS Coronavirus. Die Kristallisation ist die Vorraussetzung für die Strukturbestimmung dieses Proteins und benötigt einen sehr hohen Reinheitsgrad des betreffenden Proteins. Die Struktur könnte eventuell helfen, die bis zu diesem Zeitpunkt unbekannte Funktion des Proteins aufzuklären, welches eventuell für die RNA Bindung verantwortlich sein könnte. Die strukturellen Studien könnten auch für das rationale Drug design nützlich sein. Zwar sind aktuell keine Fälle von SARS aufgetreten, doch die Epidemiologen halten ein erneutes Auftreten in der Zukunft für möglich. Deshalb ist es die beste Vorbereitung, sich mit der gesamten Biologie des Virus zu befassen, um auf mögliche Ausbrüche von SARS vorbereitet zu sein.

1. Summary

Last year February 2003, almost 9000 people all over the world have been diagnosed with SARS, and about 800 have died of the disease. This year again in the winter, there were few cases (~9) but through the laboratory leak. A new type of coronavirus has been isolated from affected tissue of SARS patients and identified as the cause of the disease. So far, no treatment is known for infections by this newly emerged pathogen.

The Coronaviridae are positive single-stranded RNA viruses that have been joint with the known coronavirus families Arteriviridae and Roniviridae in the order Nidovirales. The genome is of about 30 kb in length that has a 5' cap structure and 3' polyadenylation tract. After infection in the host cell, the 5'- open reading frame (ORF) of the viral genome is translated into a large polyprotein. This polyprotein is cleaved by viral-encoded proteinases to release several nonstructural proteins, including an RNA-dependent RNA polymerase (Rep) and an adenosine triphosphatase (ATPase) helicase (Hel). These proteins, in turn, are responsible for replicating of the virus.

This work aims at expression, purification and crystallization of one of the non-structural protein number 8. Crystallisation of the nsp8 is prerequisite for the structure determination and need highly pure protein. Structure will eventually help in finding out the function of this protein which is unknown till the date, although its role in RNA binding has been speculated. The structural studies will eventually help in drug designing. Although there are no more cases of SARS now but the epidemiologist predict, it may emerge again in future. Therefore, it is good to prepare ourselves in advance with whole biology of the virus.

2. Einleitung

2.1 Coronaviren

Coronaviren (Coronaviridae) sind eine seit langem bekannte Familie von Viren. In ihr sind die beiden Gattungen Coronavirus und Torovirus enthalten. In der Gattung Coronavirus gibt es 13 verschiedene Arten, die Wirbeltiere infizieren. Sie verursachen vor allem die Erkrankungen des Gastrointestinaltraktes und Respirationstraktes bei Menschen und Nutztieren, wie zum Beispiel der Transmissible Gastroenteritis Virus (TGEV) bei Schweinen und Felines infektiöses Peritonitis Virus (FIPV) bei Katzen (Jin Sik Oh et al., 2003). Das humane Coronavirus (HCV) dagegen verursacht den relativ mild verlaufenden grippalen Infekt, für den dieses Virus in etwa 30% der Fälle verantwortlich ist (Stock, 2004). Da die Erkrankungen beim Menschen im allgemeinen mild verlaufen, gab es bisher keinen Grund, einen Impfstoff dagegen zu entwickeln. Für Nutztiere gibt es bereits einen Impfstoff, da z.B. die durch das TGEV verursachte Krankheit bei Schweinen grossen ökonomischen Schaden anrichten kann. Die Folgen der Infektion sind für die Nutztiere oft tödlich. Ferkel haben fast eine 100%ige Letalität bei dem Befall durch das TGEV. Die Coronaviren haben eine relativ begrenzte Anzahl Wirte. Sie befallen nur ihre eigentlichen Wirte oder verwandte Arten. Es ist interessant, dass die Wirtkompetenz mit der Benutzung des viralen Rezeptors zusammenhängt (Benbacer et al., 1997).

Die Morphologie des Coronavirus ist relativ komplex. Den Namen hat das Virus für seine unregelmässig geformte Oberfläche erhalten, auf welcher in regelmässigen Abständen Spikeproteine verankert sind. Diese verbreitern sich nach aussen keulenartig, so dass die Oberfläche an einen Kranz (dt. für corona) erinnert (Abb.1). Die Coronaviren haben einen Durchmesser von 60 bis 200 nm. Die Coronaviren gehören der vierten Gruppe nach der Baltimore Klassifikation an. Sie gehören zu der Klasse der positiv-Strang (+)RNA-Viren. Coronaviren sind umhüllt und haben eine Genomgrösse von 27 bis 31 Kb, die grösste unter RNA-Viren. Der positive RNA-Strang kann direkt für die Proteinbiosynthese benutzt werden. Dieser dient dann als mRNA zur Proteinbiosynthese. Es ist also nicht notwendig, die Proteinbiosynthese über einen Umweg über die DNA durchzuführen.

2.2 SARS Coronavirus und Replikationsstrategie

Abbildung in dieser Leseprobe nicht enthalten

Abb. 2 Oberkörper-Radiographie eines SARS-Patienten (www.hms.harvard.edu/sitn/presentations2003/week7/2week7.pdf)

Im Februar 2003 ist ein neuer humaner Coronavirustyp entdeckt worden, welcher eine viel gefährlichere Infektion der oberen Luftwege verursacht, als die bisher bekannten Typen. Das SARS Coronavirus (severe acute respiratory Syndrom, oder zu deutsch Schweres Akutes Atemweg Syndrom) breitete sich rasch aus der südlichen Provinz Chinas Guangdong aus. Die WHO zählte zwischen Februar und Juni 2003 ~8500 mit SARS infizierte Menschen, davon starben >800. Die Todesrate lag, vom Alter der Person abhängig, bei etwa 10%. Die typischen, grippeähnlichen Symptome traten nach 2 bis 7 Tagen Inkubationszeit auf. Es waren hohes Fieber (über 38 °C), Muskelschmerzen, Kurzatmigkeit und starker Rückgang der Lymphozyten im Blut (Lymphopenie). Die Infektion konnte durch Oberkörper-Radiographie nachgewiesen werden. Dabei ist die Infektion als eine Art Schatten zu sehen (Abb. 2). In 38% der Fälle waren als Folge der schweren Lungenentzündung Beatmungsgeräte notwendig. (Stadler et. al, 2003) Die Verbreitung der Epidemie erfolgte über orale oder fäkale Aerosole. Die fehlende, effiziente Therapie machte SARS Coronavirus zu einer weltweiten Gefahr.

Der erste Schritt der Replikation eines Coronavirus ist das Anheften des Viruspartikels an die Plasmamembran der Zielzelle (Abb. 3). Der Bindungsrest an der Zielzelle ist eine 9-O-acetylierte Neuraminsäure, welche bei der Hälfte aller Glycoproteine oder Glycolipide vorkommt. Unterschiedliche Coronaviren könnten auch andere Isomere der 9-O-Neuraminsäure bevorzugen. Nach der Anheftung mit Hilfe des Spikeproteins (S), wobei die S1 Domäne des Spike-Proteins eine entscheidende Rolle spielt, an den spezifischen Rezeptor (APN) der Wirtszelle wird die Fusion der Zellmembran mit dem Virus bewirkt, dessen Folge die Penetration in die Zelle ist, woran die S2 Domäne beteiligt ist. Die Aminopeptidase N (APN) wurde als Rezeptor für TGEV, FIPV und die humanen Coronaviren an den Schweine-, Katzen und menschlichen Zellen identifiziert. Die Aminopeptidase N gehört zu der grossen Familie der membrangebundenen Metallopeptidasen und wird an vielen diversen Zelltypen ausgeprägt (Oh et al., 2003). Dabei besteht eine Korrelation zwischen der Ausprägung des Rezeptors und der Bindungswahrscheinlichkeit des viralen Partikels (Kanchan Anand Ph.D Thesis). Nach der erfolgreichen Penetration wird das Nukleocapsid in die Zelle entlassen, die Hülle bleibt dagegen ausserhalb der Zelle. Dieser Prozess des Enthüllens (uncoating) wirft noch einige bislang ungeklärte Fragen auf. Das Genom eines SARS Coronavirus ist ~29.7 Kb lang und enthält 14 offene Leseraster (ORF), welche am 5´- und 3´-Ende von nicht translatierten Sequenzen von 265 bis 342 Nukleotiden „flankiert“ sind. (Snijder et al. 2003) Dabei kodieren die 14 ORFs insgesamt drei verschiedene Proteinklassen: 1. die Strukturproteine (S, M, N und E), die Nicht-Struktur Proteine, welche an der viralen RNA-Synthese beteiligt sind und Proteine, die scheinbar nicht für die Replikation des Virus von Bedeutung sind, aber in vivo einen Selektionsvorteil bringen. (Sutton et al. 2004). Das Genom (plus-Strang RNA) ist mit einer Cap-Struktur am 5´-und einem Poly(A)-Schwanz am 3´-Ende versehen. Es dient direkt als mRNA, welche sogleich im Cytoplasma des Wirts ribosomal translatiert wird.

Abbildung in dieser Leseprobe nicht enthalten

Abb. 3 Schematische (links) und elektronenmikroskopische Darstellung eines Replikationkreislaufs des SARS Coronavirus in der Wirtszelle. 1. Penetration in die Wirtszelle, 2. Die plus-Strang RNA dient zur Translation und Synthese neuer (+)RNA Stränge über die negativ-Strang RNA und Translation der 14 ORF´s. 3. Zusammenbau der einzelnen Proteine zum fertigen Viruspartikel im Golgi 4. (nur schematisch) Austritt der Virions über Knospung (Budding) http://www.hms.harvard.edu/sitn/presentations2003/week7/2week7.pdf

Die Translation-Maschinerie des Wirtes translatiert zunächst zwei Polyproteine, pp1a (486 kDa) und pp1ab (790 kDa). Die Kodierung dieses 21 Kb umfassenden Replicasegens (Abb. 4) befindet sich auf den überlappenden offenen Leseraster 1a und 1b (ORF1a und ORF1b), wobei die Expression des 1b Leserasters stromaufwärts von dem 1a Stop-Codons stattfindet. Dabei muss die Leserasterverschiebung am Ribosom um (-1) passieren. Für die Aufspaltung dieser Polyproteine (pp1a und pp1ab) und die darauf folgende Freisetzung des Replikationkomplexes sind die mittranslatierten viralen Proteasen verantwortlich, wie z.B. die Hauptprotease (MPro). Durch die Freisetzung bilden sich funktionelle Proteine wie die RNA-abhängige RNA-Polymerase und Helicase. Diese synthetisieren zunächst negativ-Strang (-)RNA auf der Grundlage des positiven-Strangs. Die negativ-Strang RNA dient als Matrix für die Synthese neuer positiver Stränge und zur diskontinuierlichen Synthese von kurzen mRNA´s, die für die Translation der Strukturproteine benötigt werden. Die Strukturproteine wandern in das Endoplasmatische Retikulum, wo sie sich zu einem Capsid zusammensetzen. Darauf erfolgt die Umhüllung durch die Plasmamembran, die durch Knospung der intrazellulären Membran des ER und des Golgi Apparat gebildet wird. Dagegen setzt sich die RNA und das Nucleocapsid-Protein zum Nucleocapsid im Cytoplasma zusammen. Die Interaktion des Nukleocapsids mit dem Membranprotein bewirkt den vollständigen Zusammenbau des viralen Partikels. Im Golgi Apparat werden noch zusätzlich die Zuckerreste an der Oberfläche des Virions modifiziert; dieses verlässt die Zelle durch Knospung („Budding“). (Stadler et al. 2003)

Abb. 4 Die Organisation des Genoms des SARS Coronavirus: Dabei wird entsprechend der Farbmarkierung angezeigt, in wieweit eine Übereinstimmung der Aminosäurensequenz zu den homologen Proteinen anderer Vertreter der Coronaviridae besteht . (Stadler et al., 2003)

Abbildung in dieser Leseprobe nicht enthalten

Die RNA-Viren wie Coronaviridae haben eine sehr hohe Mutationsrate, da die RNA-abhängige RNA-Polymerase keine Korrekturlesefunktion besitzt. Aus diesem Grund passen sie sich sehr schnell an die Abwehrmassnahmen des Wirtes an. Auf der Basis der klassischen Überkreuz-Reaktivität der Antigene (Idiotyp Antikörper Reaktion) konnten die Coronaviridae in drei Gruppen eingeteilt werden, genannt Gruppe 1, 2 und 3. Durch die phylogenetische Analyse der Replicase Region konnte diese Einteilung bestätigt werden (Snijder et al. 2003). Es hat sich gezeigt, dass sich unterschiedliche Regionen des Genoms durch Co-Evolution verändert haben. Die Rekombination zwischen den einzelnen Gruppen schien keine Rolle gespielt zu haben. Zwar gab es keine 100% Übereinstimmung zwischen den beiden Einteilungen (phylogenetisch und immunologisch), dennoch wurden genügend Übereinstimmungen gefunden, um die Einteilung beizubehalten. Es ist anzumerken, dass die Angehörigen ein und derselben Gruppe aus diesem Grund keine Antigen-Überkreuz Reaktion zeigen müssen. Dabei hat es sich gezeigt, dass das SARS Coronavirus eine neue, eigene Gruppe darstellt. Diese ist aber näher verwandt mit der Gruppe 2, was ein Zeichen dafür sein könnte, dass es früher einmal zu dieser Gruppe gehört hat. Das SARS Coronavirus hat eine co-Evolution erfahren. (Snijder et al. 2003)

Da die Aminosäuresequenz des SARS Coronavirus, insbesondere für die Nicht-Struktur Proteine 1 bis 9, nur wenig Übereinstimmung mit den Aminosäuresequenzen der anderen Coronaviren zeigt, ist deren Funktion noch sehr unklar. Das SARS Coronavirus bildet eine eigene neue Gruppe unter den Coronaviridae. Aus diesem Grund kann man auch keine vorhandenen Anti-Coronaviren Impfstoffe gegen dieses Virus einsetzen.

Es ist im folgenden ist die Aminosäurensequenz des rekombinanten nsp8 dargestellt. Es ist zu beachten, dass das Protein einen Histag (6 Histidine) am C-Terminus trägt.

MAIASEFSSLPSYAAYATAQEAYEQAVANGDSEVVLKKLKKSLNVAKSEFDRDAAMQRKLEKMADQAMTQMYKQARSEDKRAKVTSAMQTMLFTMLRKLDNDALNNIINNARDGCVPLNIIPLTTAAKLMVVVPDYGTYKNTCDGNTFTYASALWEIQQVVDADSKIVQLSEINMDNSPNLAWPLIVTALRANSAVKLQHHHHHH(C-terminus, histag)

Das Molekulargewicht des nsp8 beträgt 22821.32 Da.

Der kalkulierte pI liegt bei 7.52 und die kalkulierte Ladung bei pH 7.0 liegt bei 1.3.

Diese Berechnungen wurden mit Hilfe von Ladungsangaben von einzelnen Aminosäuren (aus Biochemistry, Stryer 3 Ausgabe) berechnet.

Sekundaerstruktur-Vorhersage der nsp8 Aminosaeuresequenz mit Hilfe der PHD-Software. (Rost B. & Sander C., 1993)

Ausgehend von der Vorhersage ist eine vorwiegend helikale Proteinstruktur des nsp8 sehr wahrscheinlich. Die Sekundaerstruktur wird durch die PHD-Software in 72% aller Fälle korrekt vorhergesagt.

Abbildung in dieser Leseprobe nicht enthalten

Vorhersage der Sekundärstruktur mit Hilfe der PHD-Software: H: Alpha-Helix, E: Beta-Faltblatt und leere Stellen: Irregulaere Sekundaerstruktur.

2.3 Zielsetzung

Die Zielsetzung meiner Arbeit war die Kristallisation des Nicht-Struktur Protein 8 des SARS Coronavirus. Die Funktion des Nicht-Struktur Proteins 8 (nsp8) ist noch unbekannt. Einige Versuche zeigten, dass das nsp8 an der RNA-Bindung mitbeteiligt ist. Es scheint mit dem nsp9 (Nicht-Struktur Protein 9) zusammenzuarbeiten oder für dessen Funktion unentbehrlich zu sein (Sutton et al. 2004). Die Variante des nsp8, mit der gearbeitet wurde, enthielt eine Modifikation. Am C-Terminus befand sich zusätzlich ein Histag aus 6 Histidinen.

Die Kristallisation eines Proteins ist der wichtigste Schritt für die Röntgenstrukturanalyse. Mit Hilfe der Struktur eines Proteins können seine Funktion aufgeklärt, aber auch mögliche Bindungsstellen für Inhibitoren gefunden werden.

Die Arbeit erfolgte als „trial and error“ System, wobei ca. 500 verschiedene Kristallisationsbedingungen ausprobiert wurden.

3. Materialien und Methoden

3.1 Materialien

3.1.1 Chemikalien

Abbildung in dieser Leseprobe nicht enthalten

3.1.2 Geräte

Abbildung in dieser Leseprobe nicht enthalten

3.2 Methoden

3.2.1 Expression von nsp8

3.2.1.1 Expression der Vorkultur

Die Expression und Aufreinigung des nsp8 wurden nach der Vorschrift von John Ziebuhr, Universität Würzburg, durchgeführt.

Für die Überexpression des rekombinanten nicht-Struktur Protein 8 wurde ein von der Arbeitsgruppe um John Ziebuhr transformierter E. coli Stamm B834 [DE3] bereitgestellt. Die Transformation des E. coli Stammes erfolgte mittels des Plasmidvektors pET-ScoV-p23, das Rückgrad des Plasmids war pET11d. Dieses Konstrukt enthält neben der Nukleotidsequenz für das nicht-Struktur Protein 8 (nsp8) noch eine Ampicillin-Resistenz. Das rekombinante Protein hat an seinem C-Terminus einen His-Tag (6 Histidine).

Es wurden zunächst 50 ml des LB-Mediums hergestellt, welches in einem 200 ml L-Schikane Erlenmeyer-Kolben autoclaviert wird. Das Animpfen der Vorkultur erfolgt unter semi-sterilen Bedingungen, welche ohne eine Sterilbench möglich sind. Dabei sollten alle Komponenten wie das sterile LB-Medium, Agar-Platten und sterile Pipettenspitzen möglichst kurz offen gehalten werden. Beim Durchführen sollte man auch darauf achten, dass man nicht in die Richtung von geöffneten Gefässen ausatmet. Ausserdem werden alle Flaschen vor dem Schliessen mit Hilfe eines Bunsenbrenners abgeflammt. Der Zusatz von Ampicillin hat zusätzlich die Kontaminationsgefahr mit Keimen aus der Umgebung verringert, da diese in der Regel keine Ampicillin-Resistenz aufweisen. Unser Klon dagegen besitzt eine Ampicillin-Resistenz, wodurch die positive Selektion ermöglicht wird.

Die Vorkultur wurde in 50 ml mit Ampicillin versetzten (100µg/ml) LB-Medium in einem L-Schikane Erlenmeyer-Kolben gestartet. Die Animpfung der Kultur erfolgte durch das „Picken“ einer Kolonie der transformierten E. coli B834 [DE3] Klone von einer auf Vorrat gegossenen Agar-Platte mit den darauf ausgesäten E. coli Klonen. Dafür wurde mit Hilfe einer Automatik Pipette (Eppendorf® Pipette) mit aufgesetzten Spitze in eine Kolonie des B834 [DE3] E. coli Klons auf der Agar-Platte gestochen. Die Pipettenspitze wurde in das im Erlenmeyer-Kolben befindliche LB-Medium eingetaucht und durch Auf- und Abpipettieren homogenisiert. Die E. coli B834 [DE3] Kultur wurde über Nacht (etwa 12 h) bei 37 °C und unter Schütteln (180 Umdrehungen pro Minute) inkubiert.

[...]

Ende der Leseprobe aus 46 Seiten

Details

Titel
Expression, Aufreinigung und Kristallisation des nicht-strukturellen Proteins 8 (nsp8) aus dem SARS-Coronavirus
Hochschule
Universität zu Lübeck  (Institut für Biochemie)
Note
2
Autor
Jahr
2004
Seiten
46
Katalognummer
V32526
ISBN (eBook)
9783638332255
ISBN (Buch)
9783638703864
Dateigröße
1472 KB
Sprache
Deutsch
Anmerkungen
Der Schwerpunkt dieser Arbeit ist die Kristallisation des nicht-strukturellen Protein 8 aus dem SARS-Coronavirus.
Schlagworte
Expression, Aufreinigung, Kristallisation, Proteins, SARS-Coronavirus
Arbeit zitieren
Wilhelm Bohr (Autor), 2004, Expression, Aufreinigung und Kristallisation des nicht-strukturellen Proteins 8 (nsp8) aus dem SARS-Coronavirus, München, GRIN Verlag, https://www.grin.com/document/32526

Kommentare

  • Noch keine Kommentare.
Im eBook lesen
Titel: Expression, Aufreinigung und Kristallisation des nicht-strukturellen Proteins 8 (nsp8) aus dem SARS-Coronavirus


Ihre Arbeit hochladen

Ihre Hausarbeit / Abschlussarbeit:

- Publikation als eBook und Buch
- Hohes Honorar auf die Verkäufe
- Für Sie komplett kostenlos – mit ISBN
- Es dauert nur 5 Minuten
- Jede Arbeit findet Leser

Kostenlos Autor werden